PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 333aa    MW: 38262.9 Da    PI: 5.3883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240988.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM141.55e-44261531128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevl 93 
                     lp G++F Ptdeel+ eyLkkk++++ l++ + ++evd+yk++P++L  ++   +e+ewyfFs+rd+ky++g+r+nr a ++gyWkatg+d++++
  XP_008240988.1  26 LPSGYQFVPTDEELIEEYLKKKIKNELLPI-NRFREVDVYKYHPEELTgMHNLLRESEWYFFSSRDRKYRNGSRPNRaADNHGYWKATGTDEKIK 119
                     699***************************.77**************8433334889********************66779************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++e++g k+tL fy g++ +g+kt+W mhey l
  XP_008240988.1 120 V-NNEVIGQKRTLDFYAGKHGEGVKTEWKMHEYVL 153
                     *.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5121181IPR003441NAC domain
PROSITE profilePS5100549.44826182IPR003441NAC domain
PfamPF023652.8E-2327153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEESNIQVAH EIFYEAWLTD KYINDLPSGY QFVPTDEELI EEYLKKKIKN ELLPINRFRE  60
VDVYKYHPEE LTGMHNLLRE SEWYFFSSRD RKYRNGSRPN RAADNHGYWK ATGTDEKIKV  120
NNEVIGQKRT LDFYAGKHGE GVKTEWKMHE YVLSENIAPS NDHKANGDMK LNDCVLCKIY  180
KNKRVKKNKN KEIADSVQSA HQPDHQEYPS PLIANSNSSS SSINHHYTAA GMSSTTVNTE  240
FGEPPYYNES FQNEAWSNYP WPITSFNSDQ TLDSADTSHG LPMNTFSSPF STDLEPTNDT  300
ALAHPSTSSQ FPHDHAKEDD NNSFDPAAQF LNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-432618317166NO APICAL MERISTEM PROTEIN
1ut4_B2e-432618317166NO APICAL MERISTEM PROTEIN
1ut7_A2e-432618317166NO APICAL MERISTEM PROTEIN
1ut7_B2e-432618317166NO APICAL MERISTEM PROTEIN
3swm_A2e-432618320169NAC domain-containing protein 19
3swm_B2e-432618320169NAC domain-containing protein 19
3swm_C2e-432618320169NAC domain-containing protein 19
3swm_D2e-432618320169NAC domain-containing protein 19
3swp_A2e-432618320169NAC domain-containing protein 19
3swp_B2e-432618320169NAC domain-containing protein 19
3swp_C2e-432618320169NAC domain-containing protein 19
3swp_D2e-432618320169NAC domain-containing protein 19
4dul_A2e-432618317166NAC domain-containing protein 19
4dul_B2e-432618317166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM2535630.0FM253563.1 Prunus cerasifera BAC insert containing Ma gene, resistant Ma1 allele, clone 76H19.
GenBankFM2535640.0FM253564.1 Prunus cerasifera BAC insert containing Ma gene, ma1 susceptible allele, clone 40K9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240988.10.0PREDICTED: protein ATAF2-like
TrEMBLM5W2D00.0M5W2D0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15078714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.13e-35NAC family protein